Explaining Medicine
  • News
  • Health & Lifestyle
    • Diet & Weight Management
    • Exercise & Fitness
    • Nutrition, Food & Recipes
    • Prevention & Wellness
  • Conditions
    • Custom1
      • Conditions A-Z
      • Procedures A-Z
      • Allergies
      • Alzheimer’s
      • Arthritis
      • Asthma
      • Blood Pressure
      • Cholesterol
      • Cancer
    • Custom2
      • Chronic Pain
      • Cold Flu
      • Depression
      • Diabetes
      • Digestion
      • Eyesight
      • Health Living
      • Healthy Kids
      • Hearing Ear
    • Custom3
      • Heart
      • HIV/AIDS
      • Infectious Disease
      • Lung Conditions
      • Menopause
      • Men’s Health
      • Mental Health
      • Migraine
      • Neurology
    • Custom4
      • Oral Health
      • Pregnancy
      • Senior Health
      • Sexual Health
      • Skin Problems
      • Sleep
      • Thyroid
      • Travel Health
      • Women’s Health
  • Medications
    • Medications
    • Supplements and Vitamins
  • Medical Dictionary
  • Health Alerts
Is It Dry Skin or Atopic Dermatitis?
Atopic Dermatitis: How to Get Enough Sleep
Atopic Dermatitis: Help for Broken Skin
Atopic Dermatitis and Food Triggers
What’s at stake as the Supreme Court hears...
Oncologists’ meetings with drug reps don’t help cancer...
Chronic Spontaneous Urticaria: What to Know
CSU: What to Wear and What to Avoid
Treatment Plan for Chronic Spontaneous Urticaria
When the Hives of CSU Don’t Go Away...
Top Posts

Explaining Medicine

  • News
  • Health & Lifestyle
    • Diet & Weight Management
    • Exercise & Fitness
    • Nutrition, Food & Recipes
    • Prevention & Wellness
  • Conditions
    • Custom1
      • Conditions A-Z
      • Procedures A-Z
      • Allergies
      • Alzheimer’s
      • Arthritis
      • Asthma
      • Blood Pressure
      • Cholesterol
      • Cancer
    • Custom2
      • Chronic Pain
      • Cold Flu
      • Depression
      • Diabetes
      • Digestion
      • Eyesight
      • Health Living
      • Healthy Kids
      • Hearing Ear
    • Custom3
      • Heart
      • HIV/AIDS
      • Infectious Disease
      • Lung Conditions
      • Menopause
      • Men’s Health
      • Mental Health
      • Migraine
      • Neurology
    • Custom4
      • Oral Health
      • Pregnancy
      • Senior Health
      • Sexual Health
      • Skin Problems
      • Sleep
      • Thyroid
      • Travel Health
      • Women’s Health
  • Medications
    • Medications
    • Supplements and Vitamins
  • Medical Dictionary
  • Health Alerts
  • News

    The Importance of a Healthy Pregnancy Weight

    by Penci January 28, 2019

    pregnant woman on scale

    As your belly expands during pregnancy, your weight is the last thing you want to worry about.

    So before you become pregnant, get yourself as close to a healthy weight as possible to help spare complications for you and your child.

    “A healthy weight and lifestyle will make it easier to get pregnant and help ensure a healthier pregnancy and postpartum period,” says Agena Davenport-Nicholson, MD, an OB/GYN at Emory University Hospital in Atlanta. Yet more than half of women are overweight or obese when they get pregnant, according to new data from the CDC.

    An overweight pregnancy is risky for mother and baby. Moms run the risk of gestational diabetes, high blood pressure, and preeclampsia — a potentially dangerous complication of high blood pressure during pregnancy. Risk for C-section is higher, too, as women who are overweight during pregnancy tend to have larger babies.

    As for babies born to overweight moms, their blood sugar can plummet dangerously low at birth. That’s because they’re cut off from their sugar source — the umbilical cord — while their body still produces enough insulin to break down all that sugar. In the long run, babies born at a higher birth weight run a greater risk of obesity and diabetes throughout life.

    While the risks of overweight pregnancy are real, you don’t have to set weight loss goals that you can’t reach before you conceive. “Even if we can’t get you to your ideal weight, if we can get you closer to that, it could make a world of difference,” says Davenport-Nicholson. “Losing just 5% to 10% of your body weight prior to pregnancy definitely helps.” If you weigh 180 pounds, 5% is just 9 pounds.

    If you’re already pregnant, this is no time to diet. Instead, strive for a healthy pregnancy that includes daily exercise and managing weight gain. Women who are overweight should gain only 15 to 25 pounds during pregnancy (11 to 20 pounds for obese women). Ask your doctor how you’re doing.

    Four Lessons

    If you’re pregnant and overweight, your focus should be on a healthy pregnancy, not weight loss. Davenport-Nicholson offers these tips:

    You’re not eating for two. Pregnant women at a normal weight only need 300 more calories a day. “It’s not double your usual intake,” she says. Ask your doctor how many calories you need. What you eat matters. Eat and drink healthy calories — your baby needs the nutrients. Choose high- protein foods that are rich in polyunsaturated fats but low in sugar, simple carbohydrates (such as those in white bread), and saturated and trans fats. Stay hydrated. You need 80 to 100 ounces of water a day. “During pregnancy, your blood volume expands, and it’s easy to get dehydrated, feel lightheaded, dizzy, and even pass out,” says Davenport-Nicholson. Exercise (almost) every day. You need at least 30 minutes of moderate physical activity most days — walking, dancing, swimming. “Swimming is great in pregnancy,” she says. “It makes you feel lighter.”

    Find more articles, browse back issues, and read the current issue of WebMD Magazine.

    WebMD Magazine – Feature Reviewed by Nivin Todd, MD on September 07, 2018

    Sources

    SOURCES:

    Agena Davenport-Nicholson, MD, Emory University Hospital, Atlanta.

    CDC.

    Stanford Children’s Health.

    Medline Plus.

    © 2019 WebMD, LLC. All rights reserved.

    Read the article here

    Share this Post

    Share Explaining Medicine Share Explaining Medicine

    The Importance of a Healthy Pregnancy Weight was last modified: January 28th, 2019 by Penci

    Related

    babybloodblood sugarbreaddiabetesexercisegestational diabetesget pregnanthealthy weighthigh blood pressureinsulinMDNivin ToddobeseoverweightpreeclampsiapregnancyproteinsugarswimmingwaterWebMD Magazineweight gainweight loss
    0 comment
    0
    Facebook Twitter Google + Pinterest
    Penci

    previous post
    Meet the Dog Scouts of America
    next post
    Someday, a Pig’s Heart Might Save an Infant’s Life

    Related Articles

    Scientists Zero in on Better Saliva-Based HIV Test

    January 29, 2018

    How to help young people limit screen time — and feel better about how they look

    February 26, 2023

    Many With Early Breast Cancer May Not Need Chemo

    June 3, 2018

    Mapping How The Opioid Epidemic Sparked An HIV Outbreak

    January 14, 2018

    Adderall shortage forces some patients to scramble, ration or go without

    February 18, 2023

    Trump Administration’s 3 Biggest Ideas For Lowering Drug Prices

    May 14, 2018

    Audit: FDA Recall Process Puts Lives at Risk

    June 9, 2016

    New MRI Test May Predict Severity of MS

    July 17, 2018

    Play Is Key to Kids’ Health, US Pediatricians Say

    August 21, 2018

    Can Diabetes Lead to Irregular Periods in Teens?

    April 25, 2018

    Recent Posts

    • Is It Dry Skin or Atopic Dermatitis?

      April 24, 2024
    • Atopic Dermatitis: How to Get Enough Sleep

      April 24, 2024
    • Atopic Dermatitis: Help for Broken Skin

      April 24, 2024
    • Atopic Dermatitis and Food Triggers

      April 24, 2024
    • What’s at stake as the Supreme Court hears Idaho case about abortion in emergencies

      April 23, 2024

    Keep in touch

    Facebook Twitter Google + RSS

    Recent Posts

    • Is It Dry Skin or Atopic Dermatitis?

      April 24, 2024
    • Atopic Dermatitis: How to Get Enough Sleep

      April 24, 2024
    • Atopic Dermatitis: Help for Broken Skin

      April 24, 2024
    • Atopic Dermatitis and Food Triggers

      April 24, 2024
    • What’s at stake as the Supreme Court hears Idaho case about abortion in emergencies

      April 23, 2024
    • Terms of Service
    • Privacy Policy

    @2026 - Explaining Medicine. All Right Reserved.


    Back To Top
    Explaining Medicine
    Proudly powered by WordPress Theme: soledad child.